Comparison

IL17C Rabbit pAb (APR18201N)

Item no. LBI-APR18201N-2
Manufacturer Leading Biology
Amount 100 ul
Quantity options 50 ul 100 ul 200 ul
Category
Format Liquid
Applications WB, IF, CHIP
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Sequence HHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
Alias IL17C, CX2, IL-17C
Available
Manufacturer - Applications
WB (Mus musculus)
IF (Mus musculus)
ChIP (Mus musculus)
Manufacturer - Category
pAbs-N
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight
Calculated MW: 21kDaObserved MW: 25kDa
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality IL17C Rabbit pAb (APR18193N7).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 19-197 of human IL17C (NP_037410.1).
Cellular localization
Secreted
Summary
The protein encoded by this gene is a T cell-derived cytokine that shares the sequence similarity with IL17. This cytokine was reported to stimulate the release of tumor necrosis factor alpha and interleukin 1 beta from a monocytic cell line. The expression of this cytokine was found to be restricted to activated T cells.
Manufacturer - Format
Liquid
Storage Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution
WB 1:500 - 1:2000
Purification
Affinity purification
Positive Control
HeLa, HepG2, HT-29, Mouse small intestine, Rat lung

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close