Comparison

c-Myc Rabbit pAb (APR19686N)

Item no. LBI-APR19686N
Manufacturer Leading Biology
Amount 50 ul
Quantity options 50 ul 100 ul 200 ul
Category
Format Liquid
Applications WB, IP, CHIP
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Sequence MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGD
Alias MRTL, MYCC, bHLHe39, c-Myc, MYC
Available
Manufacturer - Applications
WB (unknow, Human Bladder Cancer, Mus musculus, Homo sapiens, Gallus gallus, Sus scrofa)
ChIP (Homo sapiens, Mus musculus)
Co-IP (Homo sapiens, Mus musculus, Homo sapiens, Gallus gallus)
IP (Homo sapiens, Mus musculus)
Manufacturer - Category
pAbs-N
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight
Calculated MW: 48kDa/50kDaObserved MW: 60KDa
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality c-Myc Rabbit pAb (APR19686N).
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human c-Myc (NP_002458.2).
Cellular localization
Nucleus, nucleolus, nucleoplasm
Summary
The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.
Manufacturer - Format
Liquid
Storage Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution
WB 1:500 - 1:2000
Purification
Affinity purification
Positive Control
HCT116, MCF7, NIH/3T3, Mouse liver

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close