« Back
Home /
MIB2 Rabbit pAb (APR24030N)

MIB2 Rabbit pAb (APR24030N)

Item no.	LBI-APR24030N-2
Manufacturer	Leading Biology
Amount	100 ul
Quantity options	50 ul 100 ul 200 ul
Category	Immunoprecipitation
Format	Liquid
Applications	IP
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Sequence	ASVTWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLR
Alias	ZZANK1, ZZZ5, MIB2
Available
Manufacturer - Applications	Co-IP (Mus musculus)
Manufacturer - Category	pAbs-N
Storage Conditions	Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight	Observed MW: 110kDa
Overview	We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality MIB2 Rabbit pAb (APR24030N).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 300-580 of human MIB2 (NP_001164158.1).
Summary	The protein encoded by this gene is an E3 ubiquitin protein ligase that mediates ubiquitination of proteins in the Notch signaling pathway. The encoded protein may be a suppressor of melanoma invasion. [provided by RefSeq, Mar 2017]
Manufacturer - Format	Liquid
Storage Buffer	Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution	WB 1:500 - 1:2000IF 1:50 - 1:200
Purification	Affinity purification
Positive Control	HeLa, BxPC-3, U-87MG, Mouse lung, Mouse testis, Mouse brain, Rat brain, Rat testis

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 11/20/2025

Express Delivery: Save 24 days

Compare

Add to wishlist

Get an offer