Comparison

Histone H3 Rabbit pAb (APR24764N)

Item no. LBI-APR24764N
Manufacturer Leading Biology
Amount 50 ul
Quantity options 50 ul 100 ul 200 ul
Category
Format Liquid
Applications WB, CHIP
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), other
Host Rabbit
Isotype IgG
Sequence REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
Alias H3.4, H3/g, H3FT, H3t, HIST3H3, Histone H3, HIST1H3A
Available
Manufacturer - Applications
WB (HL-60)
ChIP ()
Manufacturer - Category
pAbs-N
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight
Calculated MW: 15kDaObserved MW: 17KDa
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality Histone H3 Rabbit pAb (APR24764N).
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human HIST3H3 (NP_003484.1).
Cellular localization
Chromosome, Nucleus
Summary
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.
Manufacturer - Format
Liquid
Storage Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution
WB 1:500 - 1:2000IHC 1:50 - 1:200IP 1:50 - 1:200ChIP 1:50 - 1:200
Purification
Affinity purification
Positive Control
HeLa, HepG2, Raji, Mouse liver, Rat lung

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close