« Back
Home /
Rad18 Rabbit pAb (APR25782N)

Rad18 Rabbit pAb (APR25782N)

Item no.	LBI-APR25782N-2
Manufacturer	Leading Biology
Amount	100 ul
Quantity options	50 ul 100 ul 200 ul
Category	Immunoprecipitation Immunofluorescence
Format	Liquid
Applications	IF, IP
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Sequence	INKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEI
Alias	RAD18, RNF73
Available
Manufacturer - Applications	IP (Mus musculus) IF (Mus musculus)
Manufacturer - Category	pAbs-N
Storage Conditions	Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight	Calculated MW: 56kDaObserved MW: 80kDa
Overview	We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality Rad18 Rabbit pAb (APR25782N).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 216-495 of human Rad18 (NP_064550.3).
Cellular localization	Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center
Summary	The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens.
Manufacturer - Format	Liquid
Storage Buffer	Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution	WB 1:500 - 1:2000
Purification	Affinity purification
Positive Control	MCF7

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 11/20/2025

Express Delivery: Save 24 days

Compare

Add to wishlist

Get an offer