« Back
Home /
[KO Validated] EEF1B2 Rabbit pAb (APR26656N)

[KO Validated] EEF1B2 Rabbit pAb (APR26656N)

Item no.	LBI-APR26656N
Manufacturer	Leading Biology
Amount	50 ul
Quantity options	50 ul 100 ul 200 ul
Category	Immunoprecipitation
Format	Liquid
Applications	IP
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Sequence	MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
Alias	EEF1B2, EEF1B, EEF1B1, EF1B
Available
Manufacturer - Applications	IP (Homo sapiens)
Manufacturer - Category	pAbs-N
Storage Conditions	Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight	Calculated MW: 24kDaObserved MW: 33kDa
Overview	We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality [KO Validated] EEF1B2 Rabbit pAb (APR26656N).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human EEF1B2 (NP_001032752.1).
Summary	This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.
Manufacturer - Format	Liquid
Storage Buffer	Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution	WB 1:500 - 1:2000IHC 1:50 - 1:200IF 1:50 - 1:200
Purification	Affinity purification
Positive Control	MCF-7, HL-60, HeLa, 293T, Mouse pancreas

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 11/20/2025

Express Delivery: Save 24 days

Compare

Add to wishlist

Get an offer