« Back
Home /
TEAD1 Rabbit pAb (APR26831N)

TEAD1 Rabbit pAb (APR26831N)

Item no.	LBI-APR26831N-2
Manufacturer	Leading Biology
Amount	100 ul
Quantity options	50 ul 100 ul 200 ul
Category	Immunohistochemistry Immunoprecipitation Western Blot Immunofluorescence CHiP
Format	Liquid
Applications	WB, IF, IP, IHC, CHIP
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Sequence	AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK
Alias	TEAD1, AA, NTEF-1, REF1, TCF-13, TCF13, TEAD-1, TEF-1
Available
Manufacturer - Applications	Co-IP (Homo sapiens) WB (Mus musculus, Homo sapiens) IF (Mus musculus) ChIP (Mus musculus) IHC (Homo sapiens)
Manufacturer - Category	pAbs-N
Storage Conditions	Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight	Calculated MW: 40kDa/47kDaObserved MW: 50kDa
Overview	We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality TEAD1 Rabbit pAb (APR26831N).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2).
Cellular localization	Nucleus
Summary	This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.
Manufacturer - Format	Liquid
Storage Buffer	Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution	WB 1:500 - 1:2000IF 1:50 - 1:200ChIP 1:50 - 1:200
Purification	Affinity purification
Positive Control	HeLa, MCF-7, Mouse kidney, Mouse heart, Rat kidney, Rat heart

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 11/20/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer