« Back
Home /
TEAD3 Rabbit pAb (APR27406N)

TEAD3 Rabbit pAb (APR27406N)

Item no.	LBI-APR27406N
Manufacturer	Leading Biology
Amount	50 ul
Quantity options	50 ul 100 ul 200 ul
Category	Immunoprecipitation Western Blot Immunofluorescence CHiP
Format	Liquid
Applications	WB, IF, IP, CHIP
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Sequence	SSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTIS
Alias	TEAD3, DTEF-1, ETFR-1, TEAD-3, TEAD5, TEF-5, TEF5
Available
Manufacturer - Applications	Co-IP (Homo sapiens) WB (Mus musculus) IF (Mus musculus) ChIP (Mus musculus) IP (Mus musculus)
Manufacturer - Category	pAbs-N
Storage Conditions	Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight	Calculated MW: 48kDaObserved MW: 49KDa
Overview	We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality TEAD3 Rabbit pAb (APR27406N).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 130-330 of human TEAD3 (NP_003205.2).
Cellular localization	Nucleus
Summary	This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is predominantly expressed in the placenta and is involved in the transactivation of the chorionic somatomammotropin-B gene enhancer. Translation of this protein is initiated at a non-AUG (AUA) start codon.
Manufacturer - Format	Liquid
Storage Buffer	Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution	WB 1:500 - 1:2000IHC 1:50 - 1:200IF 1:50 - 1:200
Purification	Affinity purification
Positive Control	Mouse heart, Mouse lung, Rat heart

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 11/20/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer