« Back
Home /
JAM2 Rabbit pAb (APR28817N)

JAM2 Rabbit pAb (APR28817N)

Item no.	LBI-APR28817N-2
Manufacturer	Leading Biology
Amount	100 ul
Quantity options	50 ul 100 ul 200 ul
Category	Immunoprecipitation
Format	Liquid
Applications	IP
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Sequence	FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
Alias	JAM2, C21orf43, CD322, JAM-B, JAMB, PRO245, VE-JAM, VEJAM
Available
Manufacturer - Applications	IP (Homo sapiens)
Manufacturer - Category	pAbs-N
Storage Conditions	Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight	Calculated MW: 29kDa/33kDa/34kDaObserved MW: 33KDa
Overview	We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality JAM2 Rabbit pAb (APR28817N).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 29-238 of human JAM2 (NP_067042.1).
Cellular localization	Cell junction, Cell membrane, Single-pass type I membrane protein, tight junction
Summary	This gene belongs to the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. The protein encoded by this gene is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types, and may play a role in lymphocyte homing to secondary lymphoid organs. Alternatively spliced transcript variants have been found for this gene.
Manufacturer - Format	Liquid
Storage Buffer	Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution	WB 1:500 - 1:2000
Purification	Affinity purification
Positive Control	NIH/3T3, SH-SY5Y, Rat brain, Rat heart

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 11/20/2025

Express Delivery: Save 24 days

Compare

Add to wishlist

Get an offer