Comparison

Gastrin-Releasing Peptide, human European Partner

Item no. HY-P0238-10mM
Manufacturer MedChem Express
CASRN 93755-85-2
Amount 10 mMx1 mL
Quantity options 10 mMx1 mL 10 mg 1 mg 500 ug 5 mg
Category
Type Peptides
Specific against other
Purity 99.84
Citations [1]Dubovy SR, et al. Expression of hypothalamic neurohormones and their receptors in the human eye. Oncotarget. 2017 Jun 3.
Smiles O=C(N1[C@@H](CCC1)C(N[C@@H](CC(C)C)C(N2[C@@H](CCC2)C(N[C@@H](C)C(NCC(NCC(NCC(N[C@@H]([C@H](O)C)C(N[C@@H](C(C)C)C(N[C@@H](CC(C)C)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCCCN)C(N[C@@H](CCSC)C(N[C@@H](CC3=CC=C(C=C3)O)C(N4[C@@H](CCC4)C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@@H](CC(N)=O)C(N[C@@H](CC5=CNC=N5)C(N[C@@H](CC6=CNC7=CC=CC=C67)C(N[C@@H](C)C(N[C@@H](C(C)C)C(NCC(N[C@@H](CC8=CNC=N8)C(N[C@@H](CC(C)C)C(N[C@@H](CCSC)C(N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](C(C)C)N
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2, VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Shipping Condition Cool pack
Available
Manufacturer - Type
Peptides
Manufacturer - Applications
Cancer-programmed cell death
Manufacturer - Targets
Bombesin Receptor
Shipping Temperature
Blue Ice
Storage Conditions
-80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)
Molecular Weight
2859.38
Product Description
Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release.
Manufacturer - Research Area
Cancer
Solubility
H2O: 100 mg/mL (ultrasonic)
Manufacturer - Pathway
GPCR/G Protein
Clinical information
No Development Reported

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 mMx1 mL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close