Comparison

Adrenocorticotropic Hormone (ACTH) (1-39), rat (TFA) European Partner

Item no. HY-P1477A-500ug
Manufacturer MedChem Express
Amount 500 ug
Quantity options 10 mMx1 mL 10 mg 1 mg 500 ug 5 mg
Category
Type Inhibitors
Specific against other
Purity 99.84
Citations [1]Lisak RP, et al. Melanocortin receptor agonist ACTH 1-39 protects rat forebrain neurons from apoptotic, excitotoxic and inflammation-related damage. Exp Neurol. 2015 Nov;273:161-7.|[2]Schulz C, et al. Endogenous ACTH, not only alpha-melanocyte-stimulating hormone, reduces food intake mediated by hypothalamic mechanisms. Am J Physiol Endocrinol Metab. 2010 Feb;298(2):E237-44.
Smiles [SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF (TFA salt)]
ECLASS 10.1 32160490
ECLASS 11.0 32160490
UNSPSC 12000000
Alias ACTH (1-39) (mouse,rat) (TFA)
Shipping Condition Cool pack
Available
Manufacturer - Type
Peptides
Manufacturer - Applications
Metabolism-protein/nucleotide metabolism
Manufacturer - Targets
Melanocortin Receptor
Shipping Temperature
Blue Ice
Storage Conditions
-80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)
Molecular Weight
4582.23 (free acid)
Product Description
Adrenocorticotropic Hormone (ACTH) (1-39), rat (TFA) is a potent melanocortin 2 (MC2) receptor agonist.
Manufacturer - Research Area
Metabolic Disease; Endocrinology
Solubility
DMSO: 100 mg/mL (ultrasonic)|H2O: 100 mg/mL (ultrasonic)
Manufacturer - Pathway
GPCR/G Protein; Neuronal Signaling
Isoform
MC2R
Clinical information
No Development Reported

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close