« Back
Home /
GLP-1(7-36), amide

GLP-1(7-36), amide

Item no.	DCC-DC10319-100mg
Manufacturer	DCChemicals
CASRN	107444-51-9
Amount	100 mg
Quantity options	100 mg 1 g 250 mg 25 mg
Category	Metabolism Diabetes Glucose Homeostasis Reagents & Chemicals Molecules
Type	Chemicals
Specific against	other
Purity	>98%
Smiles	[HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2]
ECLASS 10.1	32160000
ECLASS 11.0	32160000
UNSPSC	12000000
Alias	Human GLP-1-(7-36)-amide,Insulinotropin,MKC253,Glucagon-like Peptide 1 (7-36) amide,GLP-1 (7-36) amide
Similar products	107444-51-9
Available
Manufacturer - Applications	GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.
Molecular Weight	3297, 63

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 mg

available

Delivery expected until 10/23/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer