Comparison

KCNH2/HERG Blocking Peptide European Partner

Item no. ALO-BLP-PC062-0.12mg
Manufacturer Alomone
Amount 120 ug
Category
Type Peptides
Format Lyophilized
Applications WB, IHC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Purity >95% (SDS-PAGE)
Formula Lyophilized Powder.
Sequence GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Shipping Condition Room temperature
Available
Manufacturer - Type
Blocking Peptide
Manufacturer - Category
BLP
Manufacturer - Targets
KCNH2
Country of Origin
Israel
Shipping Temperature
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
Storage Conditions
Storage before Reconstitution: Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C - Storage after Reconstitution: -20°C.
Manufacturer - Format
Lyophilized powder
Short description
A Blocking Peptide for Anti-KCNH2/HERG Antibody
Description
A Blocking Peptide for Anti-KCNH2/HERG Antibody
Standard quality control of each lot
Western blot analysis.
Peptide confirmation
Confirmed by DNA sequence and SDS-PAGE
Part of Immunogen
GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG)
PH
7, 4
UNSPSC
41116161
Antigen Preadsorption Control
3 µg fusion protein per 1 µg antibody

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 120 ug
Available: In stock
available

Delivery expected until 1/29/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close