« Back
Home /
LL - 37

LL - 37

Manufacturer	peptides & elephants
Category	Peptides & Proteins Peptides
Type	Peptides
Specific against	other
Amount	1 mg
Item no.	EP11651_1
eClass 6.1	34160400
eClass 9.0	32160409
Available
Description	The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). Antimicrobial peptide LL-37 belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.
Keywords	[LL-37, 37 aa] other name: Baculoviral IAP repeat-containing protein 7 (280-289); ML-IAP 280-289
Sequence	[LL-37, 37 aa]
N-Terminus	H
C-Terminus	OH
Purity	0, 95
Counter-Ion	TFA
Storage	Store dry at -20°C

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 6/13/2024