Comparison

Recombinant Human Tumor necrosis factor receptor superfamily member 4/TNFRSF4/OX40

Item no. NOVP-C1132-1mg
Manufacturer Novoprotein Scientific
Amount 1 mg
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Purity Greater than 95% as determined by SEC-HPLC & reducing SDS-PAGE.
Sequence LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTV CRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQL CTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHF SPGDNQACKPWTNCTLAGKHTLQPASNSSDAICED RDPPATQPQETQGPPARPITVQPTEAWPRTSQGPS TRPVEVPGGRAVAHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Tumor necrosis factor receptor superfamily member 4,TNFRSF4,OX40,CD134,Txgp1
Shipping Condition Room temperature
Available
Shipping Temperature
Ambient
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Description
Recombinant Human Tumor necrosis factor receptor superfamily member 4/TNFRSF4/OX40 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu29-Ala216) of Human OX40/TNFRSF4 fused with a 6His tag at the C-terminus.
Formulation
PBS, pH7.4
Background
OX40, also termed CD134 & TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival & homeostasis of effector & memory T cells. OX40 is expressed on CD4+ & CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand & CD28-B7. The interaction between OX40 & OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs). The T-cell functions, including cytokine production, expansion, & survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function & differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, & T-cell-mediated inflammatory diseases.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug).
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in distilled water.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close