Comparison

[Novoprotein] Recombinant E. coli Ecotin (C-6His)

Item no. NOVP-C130-10ug
Manufacturer Novoprotein Scientific
Amount 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Escherichia coli (E.coli)
Host E.coli
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQ AEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDC NLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMM ACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTP DNVDVKYRVWKAEEKIDNAVVRLEHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Ecotin,eco,eti
Similar products ecotin
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
19, 16
Description
Recombinant E.coli Ecotin is produced by our E.coli expression system & the target gene encoding Met1-Arg162 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 300mM NaCl, pH 8.5.
Background
Ecotins are dimeric periplasmic proteins from Escherichia coli & related Gram-negative bacteria that have been shown to be potent & general inhibitors of many trypsin-fold serine proteases of widely varying substrate specificity, which belong to MEROPS peptidase family S1. Ecotin protein inhibits chymotrypsin, trypsin, elastases, factor X, kallikrein as well as a variety of other proteases & has been characterized as an extremely potent anticoagulant & reversible tight-binding inhibitor of human factor Xa (FXa). The power of inhibition is not linked to specific protease specificity. Immobilized Ecotin has been used to affinity-purify recombinant trypsinogen, indicating that it may also be used to purify additional serine protease zymogens. Compared to other serine protease inhibitors such as members of the serpin family, the reactive site of ecotin is Met104 (P1). Phylogenetic analysis suggested that Ecotin has an exogenous target, possibly neutrophil elastase. Ecotin from E. coli, Yersinia pestis, & Pseudomonas aeruginosa, all species that encounter the mammalian immune system, inhibit neutrophil elastase strongly while ecotin from the plant pathogen Pantoea citrea inhibits neutrophil elastase 1000-fold less potently. Ecotins all potently inhibit pancreatic digestive peptidases trypsin & chymotrypsin, while showing more variable inhibition of the blood peptidases Factor Xa, thrombin, & urokinase-type plasminogen activator. Ecotin is synthesized as a 162 amino acid precursor with a 20 amino acid signal peptide necessary to direct it to the periplasmic space.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Met1-Arg162

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close