Comparison

[Novoprotein] Recombinant Human C-C Motif Chemokine 4/CCL4 (C-6His)

Item no. NOVP-C569-10ug
Manufacturer Novoprotein Scientific
Amount 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLC SQPAVVFQTKRSKQVCADPSETWVQEYVYDLELNV DHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias C-C Motif Chemokine 4,G-26 T-Lymphocyte-Secreted Protein,HC21,Lymphocyte Activation Gene 1 Protein,LAG-1,MIP-1-Beta(1-69),Macrophage Inflammatory Protein 1-Beta,MIP-1-Beta,PAT 744,Protein H400,SIS-Gamma,Small-Inducible Cytokine A4,T-Cell Activation Protein 2,ACT-2,CCL4,LAG1,MIP1B,SCYA4
Shipping Condition Room temperature
Available
Shipping Temperature
Ambient
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
8, 87
Description
Recombinant Human C-C Motif Chemokine 4 is produced by our Mammalian expression system & the target gene encoding Ala24-Asn92 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.5.
Background
C-C Motif Chemokine 4 (CCL4) is a secreted protein which belongs to the intercrine beta (chemokine CC) family. CCL4 is a chemoattractant for natural killer cells, monocytes & a variety of other immune cells. CCL4 is a major HIV-suppressive factor produced by CD8+ T cells. Recombinant CCL4 induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, & simian immunodeficiency virus (SIV). The processed form CCL4 (3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 & to inhibit the CCR5-mediated entry of HIV-1 in T-cells. CCL4 (3-69) is also a ligand for CCR1 & CCR2 isoform B.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close