Comparison

Recombinant Human CXCL6 (C-6His)

Item no. NOVP-C598-10ug
Manufacturer Novoprotein Scientific
Amount 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAG PQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKIL DSGNKKNVDHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias C-X-C Motif Chemokine 6,Chemokine Alpha 3,CKA-3,Granulocyte Chemotactic Protein 2,GCP-2,Small-Inducible Cytokine B6,CXCL6,GCP2,SCYB6
Shipping Condition Room temperature
Available
Manufacturer - Category
Target Proteins & Cytokines / Cytokines
Manufacturer - Conjugate / Tag
C-6His
Shipping Temperature
The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below.
Storage Conditions
Lyophilized protein should be stored at ≤ -20°C, stable for one year after receipt. Reconstituted protein solution can be stored at 2-8°C for 2-7 days. Aliquots of reconstituted samples are stable at ≤ -20°C for 3 months.
Molecular Weight
9.35 KDa
Description
Recombinant Human C-X-C Motif Chemokine 6 is produced by our Mammalian expression system and the target gene encoding Gly38-Asn114 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Trehalose, 1mM EDTA, pH 7.4.
Shelf Life
24 Months

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close