« Back
Home /
[Novoprotein] Recombinant Mouse Probable Carboxypeptidase PM20D1/PM20d1 (C-6His)

[Novoprotein] Recombinant Mouse Probable Carboxypeptidase PM20D1/PM20d1 (C-6His)

Item no.	NOVP-C768-500ug
Manufacturer	Novoprotein Scientific
Amount	500 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Category	Neuroscience Aging & Neurological Disorders Peptides & Proteins Cardiovascular Research Heart Failure Myocardial Infarction Enzymes
Type	Proteins Recombinant
Format	Liquid
Specific against	Mouse (Murine, Mus musculus)
Host	Human
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Dry ice	Yes
Sequence	STGPRSRENRGASRIPSQFSEEERVAIKEALKGAI QIPTVSFSHEESNTTALAEFGEYIRKAFPTVFHSS LVQHEVVAKYSHLFTIQGSDPSLQPYMLMAHIDVV PAPEEGWEVPPFSGLERNGFIYGRGALDNKNSVMA ILHALELLLIRNYSPKRSFFIALGHDEEVSGEKGA QKISALLQARGVQLAFLVDEGSFILEGFIPNLEKP VAMISVTEKGALDLMLQVNMTPGHSSAPPKETSIG ILS
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Probable carboxypeptidase PM20D1,Peptidase M20 domain-containing protein 1,Pm20d1
Available
Shipping Temperature	The product is shipped on dry ice/ice packs.
Storage Conditions	Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Molecular Weight	54, 2
Description	Recombinant Mouse PMKase is produced by our Mammalian expression system & the target gene encoding Ser25-Leu503 is expressed with a 6His tag at the C-terminus.
Formulation	Supplied as a 0.2 um filtered solution of PBS, pH7.4.
Background	Probable carboxypeptidase PM20D1(PM20d1) is a secreted protein & belongs to the peptidase M20A family.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length	Ser25-Leu503

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

NOVP-C768-500ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 9/18/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer