Comparison

[Novoprotein] Recombinant Mouse Nerve Growth Factor Receptor/NGFR/TNFRSF16/CX271 (C-Fc)

Item no. NOVP-C787-10ug
Manufacturer Novoprotein Scientific
Amount 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host Human
Conjugate/Tag Fc
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence GAKETCSTGMYTHSGECCKACNLGEGVAQPCGANQ TVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMS APCVEADDAVCRCSYGYYQDEETGRCEACSVCGVG SGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLP CTVCEDTERQLRECTPWADAECEEIPGRWITRSTP PEGSDVTTPSTQEPEAPPERDLIASTVADTVTTVM GSSQPVVTRGTADNVDDIEGRMDEPKSCDKTHTCP PCP
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Nerve growth factor receptor (TNFR superfamily,member 16),Tumor necrosis factor receptor superfamily member 16,Ngfr
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
56, 15
Description
Recombinant Mouse Nerve Growth Factor Receptor is produced by our Mammalian expression system & the target gene encoding Gly20-Asn243 is expressed with a Fc tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Background
Mouse Tumor necrosis factor receptor superfamily member 16(TNFRSF16) is a single-pass type I membrane protein which contains 1 death domain & 4 TNFR-Cys repeats. It has low affinity receptor which can bind to NGF, BDNF, NT-3, & NT-4. It can mediate cell survival as well as cell death of neural cells. TNFRSF16 plays a role in the regulation of the translocation of GLUT4 to the cell surface in adipocytes & skeletal muscle cells in response to insulin, probably by regulating RAB31 activity, & thereby contributes to the regulation of insulin-dependent glucose uptake. It binds to rabies virus glycoprotein Gs. Necessary for the circadian oscilllation of the clock genes ARNTL/BMAL1, PER1, PER2 & NR1D1 in the suprachiasmatic nucleus (SCN) of the brain & in liver & of the genes involved in glucose & lipid metabolism in the liver.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Gly20-Asn243

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close