« Back
Home /
[Novoprotein] Recombinant Human Cyclin-Dependent Kinase 7/CXK7 (N-6His)

[Novoprotein] Recombinant Human Cyclin-Dependent Kinase 7/CXK7 (N-6His)

Item no.	NOVP-C842-1mg
Manufacturer	Novoprotein Scientific
Amount	1 mg
Quantity options	10 ug 1 mg 500 ug 50 ug
Category	Oncology Neuroscience Neural Lineage Markers By Cell Type Blastoma Carcinoma Hematology Leukemia Peptides & Proteins Cell Biology Cell Status Proliferation Enzymes By Organ Bladder Cancer
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Dry ice	Yes
Sequence	MGSSHHHHHHSSGLVPRGSHMALDVKSRAKRYEKL DFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSE AKDGINRTALREIKLLQELSHPNIIGLLDAFGHKS NISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLAD FGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMY GVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRI FET
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cyclin-Dependent Kinase 7,39 kDa Protein Kinase,p39 Mo15,CDK-Activating Kinase 1,Cell Division Protein Kinase 7,Serine/Threonine-Protein Kinase 1,TFIIH Basal Transcription Factor Complex Kinase Subunit,CDK7,CAK,CAK1,CDKN7,MO15,STK1
Similar products	CDK7
Available
Shipping Temperature	The product is shipped on dry ice/ice packs.
Storage Conditions	Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Molecular Weight	41, 2
Description	Recombinant Human Cyclin-Dependent Kinase 7 is produced by our E.coli expression system & the target gene encoding Met1-Phe346 is expressed with a 6His tag at the N-terminus.
Formulation	Supplied as a 0.2 um filtered solution of 50mM PB, 100mM NaCl, 5mM DTT, 20%Glycerol pH7.0.
Background	Cyclin-dependent kinase 7 (CDK7) belongs to the CMGC Ser/Thr superfamily, CDK7 colocalizes with PRKCI in the cytoplasm & nucleus, translocating from the nucleus to cytoplasm & perinuclear region in response to DNA-bound peptides. As a serine/threonine kinase CDK7 is involved in cell cycle control & RNA polymerase II-mediated RNA transcription. In addition, CDK7 is the catalytic subunit of the CDK-activating kinase complex, which phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 & CDK11B/CDK11.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length	Met1-Phe346

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 10/16/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer