« Back
Home /
Recombinant Human MAN1B1 (C-6His)

Recombinant Human MAN1B1 (C-6His)

Item no.	NOVP-C918-1mg
Manufacturer	Novoprotein Scientific
Amount	1 mg
Quantity options	10 ug 1 mg 500 ug 50 ug
Category	Oncology By Cell Type Carcinoma Sarcoma Peptides & Proteins Enzymes
Type	Proteins Recombinant
Format	Solution
Specific against	Human (Homo sapiens)
Host	Human
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Dry ice	Yes
Sequence	DHWKALAFRLEEEQKMRPEIAGLKPANPPVLPAPQ KADTDPENLPEISSQKTQRHIQRGPPHLQIRPPSQ DLKDGTQEEATKRQEAPVDPRPEGDPQRTVISWRG AVIEPEQGTELPSRRAEVPTKPPLPPARTQGTPVH LNYRQKGVIDVFLHAWKGYRKFAWGHDELKPVSRS FSEWFGLGLTLIDALDTMWILGLRKEFEEARKWVS KKLHFEKDVDVNLFESTIRILGGLLSAYHLSGDSL FLR
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Endoplasmic Reticulum Mannosyl-Oligosaccharide 1,2-Alpha-Mannosidase,ER Alpha-1,2-Mannosidase,ER Mannosidase 1,ERMan1,Man9GlcNAc2-Specific-Processing Alpha-Mannosidase,Mannosidase Alpha Class 1B Member 1,MAN1B1
Available
Manufacturer - Category	Target Proteins & Cytokines / Target Proteins
Manufacturer - Conjugate / Tag	C-6His
Shipping Temperature	The product is shipped on dry ice/polar packs. Upon receipt, store it immediately at the temperature listed below.
Storage Conditions	Store at ≤ -70°C, stable for 6 months after receipt. Store at ≤ -70°C, stable for 3 months under sterile conditions after opening. Please minimize freeze-thaw cycles.
Molecular Weight	68.7 KDa
Description	Recombinant Human Endoplasmic Reticulum Mannosyl-Oligosaccharide 1, 2-α-Mannosidase/MAN1B1 is produced by our Mammalian expression system and the target gene encoding Asp106-Ala699 is expressed with a 6His tag at the C-terminus.
Formulation	Supplied as a 0.2 μm filtered solution of 50mM Tris-HCl, 10mM reduced Glutathione, pH 8.0.
Shelf Life	24 Months

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

NOVP-C918-1mg-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 9/18/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer