Comparison

[Novoprotein] Recombinant Mouse/Rat Bone Morphogenetic Protein 7

Item no. NOVP-C934-10ug
Manufacturer Novoprotein Scientific
Amount 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host Human
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence STGGKQRSQNRSKTPKNQEALRMASVAENSSSDQR QACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGE CAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCA PTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias SH2 Domain-Containing Protein 1A,Duncan Disease SH2-Protein,Signaling Lymphocytic Activation Molecule-Associated Protein,SLAM-Associated Protein,T-Cell Signal Transduction Molecule SAP,SH2D1A,DSHP,SAP
Shipping Condition Room temperature
Available
Shipping Temperature
Ambient
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
15.6kD
Description
Recombinant Mouse/Rat Bone Morphogenetic Protein 7 is produced by our Mammalian expression system & the target gene encoding Ser292-His430 is expressed.
Formulation
Lyophilized from a 0.2 um filtered solution of 4mM HCl.
Background
Bone morphogenetic protein 7 (BMP-7) is a widely expressed TGF-ß superfamily member with important functions during embryogenesis, in the adult, & in disease. The growth factor domain of mouse BMP-7 shares 98% & 100% aa sequence identity with human & rat BMP-7, respectively. The BMP-7 propeptide is cleaved intracellularly but remains in association with the growth factor domain. BMP-7 is subsequently secreted as a tetramer that consists of two propeptides & two disulfide-linked growth factor domains. Mature BMP-7 can also form disulfide-linked heterodimers with BMP-2 or BMP-4, complexes that show increased potency & range of activity compared to BMP-7 homodimers. BMP-7 exerts its biological effects through the type 2 receptors Activin RIIA, Activin RIIB, & BMPR-II & the type 1 receptors Activin RIA, BMPR-IA, & BMPR-IB. BMP-7 plays a role in a variety of organ systems. It promotes new bone formation & nephron development, inhibits the branching of prostate epithelium, & antagonizes epithelial-mesenchymal transition (EMT). In pathological conditions, BMP-7 inhibits tumor growth & metastasis, ameliorates fibrotic damage in nephritis, & promotes neuroregeneration following brain ischemia.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close