Comparison

[Novoprotein] Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1/CXK2AP1 (C-6His)

Item no. NOVP-C977-50ug
Manufacturer Novoprotein Scientific
Amount 50 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQY RQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAII EELGKEIRPTYAGSKSAMERLKRGIIHARGLVREC LAETERNARSVDHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Cyclin-Dependent Kinase 2-Associated Protein 1,CDK2-Associated Protein 1,Deleted in Oral Cancer 1,DOC-1,Putative Oral Cancer Suppressor,CDK2AP1,CDKAP1,DOC1
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
13, 4
Description
Recombinant Human CDK2AP1 is produced by our Mammalian expression system & the target gene encoding Met1-Ser115 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM Tris, 150mM NaCl, pH8.0.
Background
Cyclin-Dependent Kinase 2-Associated Protein 1 (CDK2AP1) is a member of the CDK2AP family. The homodimeric structure of CDK2AP1 includes an intrinsically disordered 60-residue N-terminal region & a four-helix bundle dimeric structure with reduced Cys-105 in the C-terminal region. The widely expressed CDK2AP1 protein is the only known specific inhibitor of CDK2, making it an important component of cell cycle regulation during G(1)-to-S phase transition. In addition, CDK2AP1 serves as a regulatory role in DNA replication during S phase of the cell cycle.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Met1-Ser115

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close