Comparison

[Novoprotein] Recombinant Mouse Granulocyte Colony-Stimulating Factor/G-CSF/CSF1

Item no. NOVP-CB75-1mg
Manufacturer Novoprotein Scientific
Amount 1 mg
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host Human
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGS VLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGC SSQALQQTQCLSQLHSGLCLYQGLLQALSGISPAL APTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQ SAMPAFTSAFQRRAGGVLAISYLQGFLETARLALH HLA
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Granulocyte colony-stimulating factor,Csf3,G-CSF
Shipping Condition Room temperature
Available
Shipping Temperature
Ambient
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
18, 8
Description
Recombinant Mouse Granulocyte Colony-Stimulating Factor is produced by our Mammalian expression system & the target gene encoding Val31-Ala208 is expressed.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Background
Granulocyte colony-stimulating factor (G-CSF) is a growth factor & an essential cytokine which belongs to the IL-6 superfamily. Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, & function of 2 related white cell populations of the blood, the granulocytes & the monocytes-macrophages. G-CSF binding to its receptor G-CSF-R which belongs to the cytokine receptor type I family depends on the interaction of alpha-helical motifs of the former & two fibronectin type III as well as an immunoglobulin-like domain of the latter. G-CSF is a cytokine that have been demonstrated to improve cardiac function & perfusion in myocardial infarction. & it was initially evaluated as a stem cell mobilizer & erythropoietin as a cytoprotective agent.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close