Comparison

Recombinant Human Cerebral Dopamine Neurotrophic Factor/CDNF/ARMETL1 (C-6His)

Item no. NOVP-CD01-10ug
Manufacturer Novoprotein Scientific
Amount 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFS LDTIEKELISFCLDTKGKENRLCYYLGATKDAATK ILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYE KTLDLASVDLRKMRVAELKQILHSWGEECRACAEK TDYVNLIQELAPKYAATHPKTELHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Cerebral dopamine neurotrophic factor,ARMET-like protein 1,Conserved dopamine neurotrophic factor,ARMETL1
Similar products CDNF
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
21, 7
Description
Recombinant Human CDNF is produced by our Mammalian expression system & the target gene encoding Gln25-Leu187 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background
erebral Dopamine Neurotrophic Factor (CDNF), also known as ARMETL1 (ARMET-like protein 1), is a secreted protein with eight conserved cysteine residues.It is belongs to the ARMET family. CDNF/ARMETL1 is a evolutionary conserved protein which can protect & restore the function of dopaminergic neurons in the rat model of Parkinson's disease, suggesting that CDNF might be beneficial for the treatment of Parkinson's disease. CDNF is widely expressed in neurons in several brain regions including cerebral cortex, hippocampus, substantia nigra, striatum & cerebellum. Human CDNF is glycosylated & secreted from transiently transfected cells. CDNF promotes the survival, growth, & function of dopamine-specific neurons & is expressed in brain regions that undergo cocaine-induced neuroplasticity.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Gln25-Leu187

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close