Comparison

Recombinant Human CD40/TNFRSF5/CD40L Receptor

Item no. NOVP-CD12-50ug
Manufacturer Novoprotein Scientific
Amount 50 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Conjugate/Tag HIS, Fc
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFT ETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLR VQQKGTSETDTICTCEEGWHCTSEACESCVLHRSC SPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEK CHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRVD DIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDG
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Tumor Necrosis Factor Receptor Superfamily member 5,B-Cell Surface Antigen CD40,Bp50,CD40L Receptor,CDw40,CD40,TNFRSF5
Similar products CD40
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
46, 3
Description
Recombinant Human TNFRSF5 is produced by our Mammalian expression system & the target gene encoding Glu21-Arg193 is expressed with a Fc, 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background
CD40 is a Type I Transmembrane Glycoprotein that belongs to the TNF Receptor Superfamily. CD40 is expressed in B cells, follicular dendritic cells, dendritic cells, activated monocytes, macrophages, endothelial cells, vascular smooth muscle cells, & several tumor cell lines. The extracellular domain of CD40 is characterized by Cysteine rich repeat regions. Interaction of CD40 with its ligand (CD40L) leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Several different TRAF proteins (adaptor proteins) have been identified to serves as mediators of the signal transduction. CD40 plays an essential role in mediating a broad variety of immune & inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, & germinal center formation.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Glu21-Arg193

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close