Comparison

Recombinant Human CD44/MIC4 (C-Fc)

Item no. NOVP-CD13-1mg
Manufacturer Novoprotein Scientific
Amount 1 mg
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Conjugate/Tag Fc
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKA FNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPR IHPNSICAANNTGVYILTSNTSQYDTYCFNASAPP EEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGE YRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIF YTFSTVHPIPDEDSPWITDSTDRIPVDDIEGRMDE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MIS
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD44 Antigen,CDw44,Epican,Extracellular Matrix Receptor III,ECMR-III,GP90 Lymphocyte Homing/Adhesion Receptor,HUTCH-I,Heparan Sulfate Proteoglycan,Hermes Antigen,Hyaluronate Receptor,Phagocytic Glycoprotein 1,PGP-1,Phagocytic Glycoprotein I,PGP-I,CD44,LHR,MDU2,MDU3,MIC4
Similar products CD44
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
49, 2
Description
Recombinant Human CD44 is produced by our Mammalian expression system & the target gene encoding Gln21-Pro220 is expressed with a Fc tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background
CD44 is a cell-surface receptor for hyaluronic acid & also interacts with other ligands, such as osteopontin, collagens, & matrix metalloproteinases. A large number of CD44 isoforms can be generated by the insertion of different combinations of at least nine exons. Increased CD44 antigen is associated with relapses in non-small cell lung cancers. Furthermore, an increasing quantity of evidence suggests that CD44 has various functions related to inflammatory disease. CD44 deficiency induces severe liver injury. CD44-hyaluronate mediates in lymphocyte T & monocyte adhesion to the endothelium, stimulates proinflammatory cytokine release from macrophages & participates in dedifferentiation phenotype of smooth muscle cells from contractile state to synthetic one.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Gln21-Pro220

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close