Comparison

Recombinant Human LAMP1/CD107a (C-Fc)

Item no. NOVP-CD15-50ug
Manufacturer Novoprotein Scientific
Amount 50 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Conjugate/Tag Fc
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence AMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNM TFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGH TLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASS KEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTV TLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPP APPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGL QLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHL VTL
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Lysosome-Associated Membrane Glycoprotein 1,LAMP-1,Lysosome-Associated Membrane Protein 1,CD107 Antigen-Like Family Member A,CD107a,LAMP1
Similar products LAMP1
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
65, 5
Description
Recombinant Human LAMP1 is produced by our Mammalian expression system & the target gene encoding Ala29-Met382 is expressed with a Fc tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background
Lysosome-Associated Membrane Glycoprotein 1 (LAMP1) is a single-pass type I membrane protein belonging to the LAMP family. LAMP1 is expressed largely in the endosome-lysosome membranes of cells.It shuttles between lysosomes, endosomes, & the plasma membrane. LAMP1 functions to present carbohydrate ligands to selectins & it has also been implicated in tumor cell metastasis. It has been proposed LAMP1 can be used as a therapeutic agent for certain cancers, as well as a marker for lysosomal storage disorders & degranulation on lymphocytes such as CD8+ & NK cells. Cell surface LAMP1 & LAMP2 have been shown to promote adhesion of human peripheral blood mononuclear cells(PBMC) to vascular endothelium, therefore they are possibly involved in the adhesion of PBMCs to the site of inflammation.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Ala29-Met382

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close