Comparison

Recombinant Mouse VEGF-D/PIGF (C-6His)

Item no. NOVP-CD18-50ug
Manufacturer Novoprotein Scientific
Amount 50 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Liquid
Specific against Mouse (Murine, Mus musculus)
Host Human
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Dry ice Yes
Sequence FYDTETLKVIDEEWQRTQCSPRETCVEVASELGKT TNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYIS KQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPR HPYSVDHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Vascular endothelial growth factor D,c-Fos-induced growth factor,FIGF,VEGFD,
Similar products VEGFD
Available
Shipping Temperature
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at < -20C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Molecular Weight
13, 1
Description
Recombinant Mouse Vascular Endothelial Growth Factor D is produced by our Mammalian expression system & the target gene encoding Phe98-Ser206 is expressed with a 6His tag at the C-terminus.
Formulation
Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background
Mouse vascular endothelial growth factor D, (VEGFD) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. VEGFD is a secreted protein & highly expressed in fetal & adult lung. It undergoes a complex proteolytic maturation, generating multiple processed forms that bind & activate VEGFR-2 & VEGFR-3 receptors. The structure & function of this protein is similar to VEGFC. VEGFD is growth factor which active in angiogenesis, lymphangiogenesis, & endothelial cell growth, stimulating their proliferation & migration & also has effects on the permeability of blood vessels.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Phe98-Ser206

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close