« Back
Home /
Recombinant Mouse Cystatin F/CST7 (C-6His)

Recombinant Mouse Cystatin F/CST7 (C-6His)

Item no.	NOVP-CD20-500ug
Manufacturer	Novoprotein Scientific
Amount	500 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Specific against	Mouse (Murine, Mus musculus)
Host	Human
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Dry ice	Yes
Sequence	ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAAR HSVEKFNNCTNDIFLFKESHVSKALVQVVKGLKYM LEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYC YSEVWVIPWLHSFEVPVLLCQVDHHHHHH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cystatin-F,Cystatin-like Metastasis-Associated Protein,Leukocystatin,CMAP,Cystatin-7,Cst7,
Similar products	Cystatin F
Available
Shipping Temperature	The product is shipped on dry ice/ice packs.
Storage Conditions	Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Molecular Weight	15, 4
Description	Recombinant Mouse Cystatin F is produced by our Mammalian expression system & the target gene encoding Ala19-Gln144 is expressed with a 6His tag at the C-terminus.
Formulation	Supplied as a 0.2 um filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Background	Mouse Cystatin F belongs to cystatin superfamily, which encompasses proteins that contain multiple cystatin-like sequences. It has been shown that Cystatin F is selectively expressed by hematopoietic cells & may be a biomarker for both liver metastasis & inflammatory lung disorders. Mouse Cystatin F inhibits papain & cathepsin L but with affinities lower than other cystatins. It may play a role in immune regulation through inhibition of a unique target in the hematopoietic system.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length	Ala19-Gln144

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 10/16/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer