« Back
Home /
BDNF/NT-3 growth factors receptor/NTRK2/TRKB

BDNF/NT-3 growth factors receptor/NTRK2/TRKB

Item no.	NOVP-CD43-500ug
Manufacturer	Novoprotein Scientific
Amount	500 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Category	Oncology Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Peptides & Proteins Recombinant Proteins Obesity Adenocarcinoma Neuronal Cell Markers
Type	Proteins
Specific against	Human (Homo sapiens)
Host	Human
Sequence	CPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEI FIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAF LKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFT CSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQI PNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWD VGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENL VGEDADSVN
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	TRKB-276Q-A
Shipping Condition	Room temperature
Available
Shipping Temperature	Ambient
Storage Conditions	Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 5 months.
Description	Recombinant Human BDNF/NT-3 growth factors receptor/NTRK2/TRKB is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Cys32-Glu430) of Human TRKB(276Q-A) fused with a polyhistidine tag at the C-terminus.
Formulation	Lyophilized from a 0.2 uM filtered solution of PBS, pH 7.4
Background	The TRK Family of Tyrosine Kinase Receptor consists of 3 members: TrkA, TrkB & TrkC. The three TRK family proteins have different ligand specificities. They connect to different neurotrophins, including NGF, BDNF, NT-3NT-4/5. TRKA binds NGF, TRKB binds BDNF & NT-3, TRKC binds NT-4/5. At the protein sequence level, human & rat TRKB have greater than 90% sequence identity & the proteins exbihit cross-species activity. TRKB is primarily expressed in the nervous system & it also expression in a wide variety of tissues with low levels.
uName	TRKB-276Q-A

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 3/5/2026

Express Delivery: Save 17 days

Compare

Add to wishlist

Get an offer