Comparison

Recombinant Human Tissue-Type Plasminogen Activator/PLAT (C-6His)

Item no. NOVP-CD67-1mg
Manufacturer Novoprotein Scientific
Amount 1 mg
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCW CNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSD FVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWS TAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGN HNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSE GNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILI GKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHV LKN
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias T-PA,TPA,t-plasminogen activator,Tissue plasminogen activator,
Similar products PLAT
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
61, 65
Description
Recombinant Human Tissue-type plasminogen activator is produced by our Mammalian expression system & the target gene encoding Ser36-Pro562 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM MES, 150mM NaCl, 0.2mM GaCl2, pH5.5.
Background
Tissue-type plasminogen activator (PLAT) is a protein that secreted into extracellular space. PLAT contains five domains: EGF-like domain, fibronectin type-I domain, 2 kringle domains & peptidase S1 domain. It belongs to the peptidase S1 family. The main function of this protein is to convert plasminogen into biologically active plasmin. As a protease, PLAT plays a crucial role in regulating blood fibrinolysis, maintaining the homeostasis of extracellular matrix & in modulating the post-translational activation of growth factors. PLAT is found not only in the blood, where its primary function is as a thrombolytic enzyme, but also in the central nervous system (CNS). It participates in a number of physiological & pathological events in the CNS, as well as the role of neuroserpin as the natural regulator of PLAT's activity in these processes. Increased or decreased activity of PLAT leads to hyperfibrinolysis or hypofibrinolysis, respectively. In addition, as a cytokine, PLAT plays a pivotal role in the pathogenesis of renal interstitial fibrosis through diverse mechanisms. Thus, as a fibrogenic cytokine, it promotes the progression of kidney diseases.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Ser36-Pro562

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close