Comparison

Recombinant Mouse Ephrin-A1/EFNA1 (C-Fc-6His)

Item no. NOVP-CD74-10ug
Manufacturer Novoprotein Scientific
Amount 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host Human
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence DRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPH YEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQV RWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEG HSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAH VNPQEKRLQADDPEVQVLHSIGYSVDDIEGRMDEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA KTK
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias EPH-related receptor tyrosine kinase ligand 1,Immediate early response protein B61,Epgl1,Epl1,Lerk1
Similar products Ephrin-A1
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
47, 3
Description
Recombinant Mouse Ephrin-A1 is produced by our Mammalian expression system & the target gene encoding Asp19-Ser182 is expressed with a Fc, 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Background
Ephrin-A1 is a cell membrane protein & contains 1 ephrin RBD (ephrin receptor-binding) domain. EFNA1 belongs to the ephrin (EPH) family. The ephrins & EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases & have been implicated in mediating developmental events, especially in the nervous system & in erythropoiesis. Based on their structures & sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, & the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, & EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis.It belongs to the ephrin family & contains 1 ephrin RBD (ephrin receptor-binding) domain.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Asp19-Ser182

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close