« Back
Home /
Recombinant Human Izumo Sperm-Egg Fusion Protein 4/ IZUMO4 (C-Fc)

Recombinant Human Izumo Sperm-Egg Fusion Protein 4/ IZUMO4 (C-Fc)

Item no.	NOVP-CD94-10ug
Manufacturer	Novoprotein Scientific
Amount	10 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Category	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	Human
Conjugate/Tag	Fc
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Sequence	HGCLHCHSNFSKKFSFYRHHVNFKSWWVGDIPVSG ALLTDWSDDTMKELHLAIPAKITREKLDQVATAVY QMMDQLYQGKMYFPGYFPNELRNIFREQVHLIQNA IIESRIDCQHRCGIFQYETISCNNCTDSHVACFGY NCESSAQWKSAVQGLLNYINNWHKQDTSMSLVSPA LRCLEPPHLANLTLEDAAECLKQHVDDIEGRMDEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISR
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Sperm 22 kDa protein c113,IZUMO4,C19orf36,UNQ831/PRO1758
Shipping Condition	Room temperature
Available
Shipping Temperature	The product is shipped at ambient temperature.
Storage Conditions	Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight	50, 1
Description	Recombinant Human IZUMO4 is produced by our Mammalian expression system & the target gene encoding His16-His214 is expressed with a Fc tag at the C-terminus.
Formulation	Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background	Izumo sperm-egg fusion protein 4 is a sperm membrane protein which plays a key role in the fusion in the mouse. IZUMO4 has an N-terminal domain with significant homology to the N-terminal domain of Izumo.It belongs to the Izumo family . Izumo 4 is a soluble protein expressed in the testis & in other tissues. Izumo domain possesses the ability to form dimers, whereas the transmembrane domain or the cytoplasmic domain or both of Izumo 1 are required for the formation of multimers of higher order.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length	His16-His214

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 10/16/2025

Express Delivery: Save 23 days

Compare

Add to wishlist

Get an offer