« Back
Home /
[Novoprotein] Recombinant Human Haptoglobin/Zonulin (C-6His)

[Novoprotein] Recombinant Human Haptoglobin/Zonulin (C-6His)

Item no.	NOVP-CD97-10ug
Manufacturer	Novoprotein Scientific
Amount	10 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins Obesity
Type	Proteins Recombinant
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	Human
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Sequence	VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCK NYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEA DDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDG VYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANP VQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLIN EQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKK QLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVM PIC
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Haptoglobin,Zonulin,HP
Shipping Condition	Room temperature
Available
Shipping Temperature	The product is shipped at ambient temperature.
Storage Conditions	Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight	44, 4
Description	Recombinant Human Haptoglobin/Zonulin is produced by our Mammalian expression system & the target gene encoding Val19-Asn406 is expressed with a 6His tag at the C-terminus.
Formulation	Lyophilized from a 0.2 um filtered solution of PBS, pH7.4, 1mM DTT.
Background	As a result of hemolysis, hemoglobin is found to accumulate in the kidney & is secreted in the urine. Haptoglobin captures, & combines with free plasma hemoglobin to allow hepatic recycling of heme iron & to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity & plays a role in modulating many aspects of the acute phase response.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length	Val19-Asn406

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 3/5/2026

Express Delivery: Save 17 days

Compare

Add to wishlist

Get an offer