« Back
Home /
[Novoprotein] Recombinant Human Cyclin-Dependent Kinase 6/CXK6 (N-6His)

[Novoprotein] Recombinant Human Cyclin-Dependent Kinase 6/CXK6 (N-6His)

Item no.	NOVP-CF11-50ug
Manufacturer	Novoprotein Scientific
Amount	50 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Category	Oncology Neuroscience Neural Lineage Markers By Cell Type Blastoma Carcinoma Glioma Hematology Lymphoma Myeloma Sarcoma Peptides & Proteins Cell Biology Cell Status Proliferation Enzymes By Organ Bladder Cancer
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Dry ice	Yes
Sequence	MGSSHHHHHHSSGLVPRGSHMEKDGLCRADQQYEC VAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTG EEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTV SRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTS SGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEV LLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDV DQL
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cyclin-Dependent Kinase 6,Cell Division Protein Kinase 6,Serine/Threonine-Protein Kinase PLSTIRE,CDK6,CDKN6
Similar products	CDK6
Available
Shipping Temperature	The product is shipped on dry ice/ice packs.
Storage Conditions	Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Molecular Weight	39, 1
Description	Recombinant Human Cyclin-Dependent Kinase 6 is produced by our E.coli expression system & the target gene encoding Met1-Ala326 is expressed with a 6His tag at the N-terminus.
Formulation	Supplied as a 0.2 um filtered solution of 50mM Tris, 100mM NaCl, 20% Glycerol, 5mM DTT, pH 8.0.
Background	Cyclin-Dependent Kinase 6 (CDK6 belongs to the CMGC Ser/Thr protein kinase family & CDC2/CDKX subfamily. CDK6 is expressed in many tissues & contains one protein kinase domain. This cyclin forms a complex with & functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. Mutations & overexpression of CDK6, which alters cell cycle progression, are observed frequently in a variety of tumors & may contribute to tumorigenesis.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length	Met1-Ala326

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

NOVP-CF11-50ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 10/16/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer