Comparison

[Novoprotein] Recombinant Human Parathyroid Hormone-Related Protein/PTHLH (C-6His)

Item no. NOVP-CF16-10ug
Manufacturer Novoprotein Scientific
Amount 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host E.coli
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence MAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA EIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLT QETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKK RRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR LEHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Parathyroid Hormone-Related Protein,PTH-rP,PTHrP,Parathyroid Hormone-Like Protein,PLP,PTHrP [1-36],PTHrP [38-94],Osteostatin,PTHrP [107-139],PTHLH,PTHRP
Similar products PTHLH
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
16, 9
Description
Recombinant Human Parathyroid Hormone-Related Protein is produced by our E.coli expression system & the target gene encoding Ala37-Arg175 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background
Parathyroid Hormone-Related protein (PTHRP) is a member of the parathyroid hormone family. PTHRP is known as a potent inhibitor of chondrocyte maturation. PTHRP is a critical regulator of cellular & organ growth, development, migration, differentiation & survival & of epithelial calcium ion transport. PTHRP also regulates epithelial-mesenchymal interactions during the formation of the mammary glands. During endochondral bone development, PTHRP plays a major role in suppressing the onset of hypertrophic differentiation. Defects in PTHRP are the cause of Brachydactyly Type E2.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Ala37-Arg175

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close