« Back
Home /
[Novoprotein] Recombinant Human Parkinson Juvenile Disease Protein 2/PARK2 (C-6His)

[Novoprotein] Recombinant Human Parkinson Juvenile Disease Protein 2/PARK2 (C-6His)

Item no.	NOVP-CF59-1mg
Manufacturer	Novoprotein Scientific
Amount	1 mg
Quantity options	10 ug 1 mg 500 ug 50 ug
Category	Oncology Neuroscience Neuroinflammation Neural Mitochondrial Function Protein Aggregation, Clearance & Misfolding By Cell Type Carcinoma Hematology Myeloma Peptides & Proteins Cell Biology Cell Status Autophagy Enzymes
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Dry ice	Yes
Sequence	MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQG VPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV QRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRV DLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGR SIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLT LTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFF KCGAHPTSDKETSVALHLIATNSRNITCITCTDVR SPV
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	E3 Ubiquitin-Protein Ligase Parkin,Parkinson Juvenile Disease Protein 2,Parkinson Disease Protein 2,PARK2,PRKN
Similar products	PARK2
Available
Shipping Temperature	The product is shipped on dry ice/ice packs.
Storage Conditions	Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Molecular Weight	43, 4
Description	Recombinant Human Parkinson Juvenile Disease Protein 2 is produced by our E.coli expression system & the target gene encoding Met1-Lys387 is expressed with a 6His tag at the C-terminus.
Formulation	Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, 2mM DTT, 20% Glycerol, pH7.4.
Background	E3 Ubiquitin-Protein Ligase Parkin (PARK2) belongs to the RBR family & Parkin subfamily. PARK2 is expressed in the heart, testis, skeletal muscle, with high expression levels found in the brain including the substantianigra. PARK2 is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. The mutations of gene encoding this protein will result in Parkinson disease & autosomal recessive juvenile Parkinson disease.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length	Met1-Lys387

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 10/16/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer