Comparison

Human IL1RN

Item no. NOVP-CG62-500ug
Manufacturer Novoprotein Scientific
Amount 500 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins
Specific against Human (Homo sapiens)
Host E.coli
Purity Greater than 95% as determined by SEC-HPLC & reducing SDS-PAGE.
Sequence GHMRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNV NLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAV NITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAME ADQPVSLTNMPDEGVMVTKFYFQEDE*
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Hyaluronidase-1,Hyal-1,Hyaluronoglucosaminidase-1,Lung Carcinoma Protein 1,LuCa-1,HYAL1,LUCA1
Similar products IL1RN
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Description
Recombinant Human Interleukin-1 Receptor Antagonist Protein/IL-1RN is produced with our E. coli expression system. The target protein is expressed with sequence (Arg26-Glu177) of Human IL1RN.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4
Background
Interleukin-1 Receptor Antagonist (IL-1RN) is a member of the IL-1 family. Endogenous IL-1RN is produced in numerous animal disease models as well as in human autoimmune & chronic inflammatory diseases. It binds to IL-1 receptors in competition with IL-1, but does not elicit intracellular response from this binding. Its role in counteracting the proinflammatory effects of IL-1 is being studied by numerous research groups. IL-4 & IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble & intracellular forms of IL-1RN. The regulated expression of IL-1RN in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts, IL-1, TNF-alpha, or PDGF markedly enhances the synthesis of IL-1RN.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug).
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in 2X PBS.
Please aliquot the reconstituted solution.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close