Comparison

[Novoprotein] Recombinant E. coli 4'-Phosphopantetheinyl Transferase ACPS

Item no. NOVP-CH15-10ug
Manufacturer Novoprotein Scientific
Amount 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Escherichia coli (E.coli)
Host E.coli
Conjugate/Tag Unconjugated
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence AILGLGTDIVEIARIEAVIARSGDRLARRVLSDNE WAIWKTHHQPVRFLAKRFAVKEAAAKAFGTGIRNG LAFNQFEVFNDELGKPRLRLWGEALKLAEKLGVAN MHVTLADERHYACATVIIES
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 4'-phosphopantetheinyl transferase AcpS,acpS,dpj
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
14, 1
Description
Recombinant E.coli 4'-phosphopantetheinyl transferase AcpS is produced by our E.coli expression system & the target gene encoding Ala2-Ser126 is expressed.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Background
Holo-[acyl-carrier-protein] synthase is an enzyme that belongs to the P-Pant transferase superfamily.AcpS family.It transfers the 4'-phosphopantetheine moiety from coenzyme A to the 'Ser-36' of acyl-carrier-protein.It catalyzes the chemical reaction: CoA-[4'-phosphopantetheine] + apo-acyl carrier protein adenosine 3', 5'-bisphosphate + holo-acyl carrier protein. This enzyme participates in pantothenate & coa biosynthesis.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Ala2-Ser126

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close