Comparison

[Novoprotein] Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein/OASLOASL (C-6His)

Item no. NOVP-CH76-50ug
Manufacturer Novoprotein Scientific
Amount 50 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Host E.coli
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Dry ice Yes
Sequence MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLD AVRTVEEFLRQEHFQGKRGLDQDVRVLKVVKVGSF GNGTVLRSTREVELVAFLSCFHSFQEAAKHLEHHH HHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 2'-5'-oligoadenylate synthase-like protein,2'-5'-OAS-related protein,2'-5'-OAS-RP,59 kDa 2'-5'-oligoadenylate synthase-like protein,Thyroid receptor-interacting protein 14,TR-interacting protein 14,TRIP-14,p59OASL,OASL,TRIP14
Similar products OASL
Available
Shipping Temperature
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at < -20C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Molecular Weight
12, 6
Description
Recombinant Human OASL is produced by our E.coli expression system & the target gene encoding Met1-His100 is expressed with a 6His tag at the C-terminus.
Formulation
Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background
2'-5'-oligoadenylate synthase-like protein (OASL) contains 2 ubiquitin-like domains, & belongs to the 2-5A synthase family. The ubiquitin-like domains are essential for its antiviral activity. OASL can be induced by type I interferon (IFN) & viruses, & expressed in most tissues such as primary blood Leukocytes & other hematopoietic system tissues, colon, stomach & to some extent in testis. OASL can specifically interacts with the ligand binding domain of the thyroid receptor (TR) without the presence of thyroid hormone. It does not have 2'-5'-OAS activity, but can bind double-stranded RNA. It also displays antiviral activity against encephalomyocarditis virus (EMCV) & hepatitis C virus (HCV) via an alternative antiviral pathway independent of RNase L.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Met1-His100

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close