Comparison

Recombinant Human Bone Morphogenetic Protein 9/BMP-9/GDF-2 (C-6His)

Item no. NOVP-CK38-500ug
Manufacturer Novoprotein Scientific
Amount 500 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAY ECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVG KACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVA ECGCR
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias GDF2,GDF-2,BMP9,BMP-9,Bone morphogenetic protein 9,GDF-2,growth differentiation factor 2,growth/differentiation factor 2
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
12, 1
Description
Recombinant Human Growth & differentiation factor 2 is produced by our Mammalian expression system & the target gene encoding Ser320-Arg429 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 4 mM HCl.
Background
Bone morphogenetic protein 9 (BMP9), also known as growth differentiation factor-2, is a member of the TGFbeta superfamily proteins that bind to type II & type I serine-threonine kinase receptors, & transduces signals through Smad & non-Smad signalling pathways. BMP9 has been shown to be a potent synergistic factor for hematopoietic progenitor generation & colony formation & may play a role in the induction & maintenance of the neuronal cholinergic phenotype in the central nervous system. ALK1 & ALK2 are important receptors for BMP9-induced osteogenic differentiation both in vitro & in vivo. BMP9 is highly expressed in the developing mouse liver, & recombinant human BMP9 stimulates hepatocyte proliferation.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Ser320-Arg429

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close