Comparison

Recombinant human Regenerating islet-derived protein 3-alpha

Item no. OPCA00200-20UG
Manufacturer AVIVA Systems Biology
Amount 20 ug
Category
Type Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Citations Molecular basis for peptidoglycan recognition by a bactericidal lectin.Lehotzky R.E., Partch C.L., Mukherjee S., Cash H.L., Goldman W.E., Gardner K.H., Hooper L.V.Proc. Natl. Acad. Sci. U.S.A. 107:7722-7727(2010)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias hepatocarcinoma-intestine-pancreas;hepatointestinal pancreatic protein;HIP;HIP/PAP;human proislet peptide;INGAP;pancreatic beta cell growth factor;pancreatitis-associated protein 1;PAP;PAP homologous protein;PAP1;PAP-H;PBCGF;proliferation-inducing protein 34;proliferation-inducing protein 42;reg III-alpha;REG3;REG-3-alpha;regenerating islet-derived 3 alpha;regenerating islet-derived protein 3-alpha;regenerating islet-derived protein III-alpha;REG-III.
Available
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Molecular Weight
43.6 kDa
Gene symbol
REG3A
Gene Fullname
regenerating family member 3 alpha
Protein size
Recombinant
Product format
Liquid or Lyophilized powder
Reconstitution and storage
-20°C or -80°C
Description of target
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
Protein name
Regenerating islet-derived protein 3-alpha
Purification
Affinity purified using AC

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close