« Back
Home /
FKBP1A Recombinant Protein (Human)

FKBP1A Recombinant Protein (Human)

Item no.	OPCA00443-100UG
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Neural Lineage Markers By Cell Type Carcinoma Glioma Hematology Lymphoma Melanoma Sarcoma Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer Neurodegeneration Markers
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVE
Citations	Complementary DNA encoding the human T-cell FK506-binding protein, a peptidylprolyl cis-trans isomerase distinct from cyclophilin.Maki N., Sekiguchi F., Nishimaki J., Miwa K., Hayano T., Takahashi N., Suzuki M.Proc. Natl. Acad. Sci. U.S.A. 87:5440-5443(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	12 kDa FK506-binding protein;12 kDa FKBP;calstabin-1;FK506 binding protein 1A,12kDa;FK506 binding protein12;FK506-binding protein 1;FK506-binding protein 12;FK506-binding protein 1A;FK506-binding protein,T-cell,12-kD;FKBP1;FKBP12;FKBP-12;FKBP12-Exip3;FKBP-1A;immunophilin FKBP12;peptidyl-prolyl cis-trans isomerase FKBP1A;PKC12;PKCI2;PPIASE;PPIase FKBP1A;protein kinase C inhibitor 2;rotamase.
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Molecular Weight	38.2 kDa
Gene symbol	FKBP1A
Gene Fullname	FKBP prolyl isomerase 1A
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Protein name	Peptidyl-prolyl cis-trans isomerase FKBP1A
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPCA00443-100UG-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 2/12/2026

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer