« Back
Home /
Recombinant human Fibroblast growth factor 19 protein

Recombinant human Fibroblast growth factor 19 protein

Item no.	OPCA00646-100UG
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Neural Lineage Markers Metabolism Diabetes Neural Signaling Neural Adhesion Molecules By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Sarcoma Peptides & Proteins Recombinant Proteins Astrocytoma Calcium Binding Protein Markers Interneuron Markers
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Citations	Structure and expression of a novel human FGF, FGF-19, expressed in the fetal brain.Nishimura T., Utsunomiya Y., Hoshikawa M., Ohuchi H., Itoh N.Biochim. Biophys. Acta 1444:148-151(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FGF-19;fibroblast growth factor 19.
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Molecular Weight	47.8 kDa
Gene symbol	FGF19
Gene Fullname	fibroblast growth factor 19
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4.
Protein name	Fibroblast growth factor 19
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPCA00646-100UG-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer