Comparison

IGF1 Recombinant Protein (Human)

Item no. OPCA00654-1MG
Manufacturer AVIVA Systems Biology
Amount 1 mg
Category
Type Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Citations Characterization of insulin-like growth factor 1 in human primary brain tumors.Sandberg-Nordqvist A.-C., Staehlbom P.-A., Reinecke M., Collins V.P., von Holst H., Sara V.Cancer Res. 53:2475-2478(1993)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias IGF;IGFI;IGF-I;insulin-like growth factor 1 (somatomedin C);insulin-like growth factor I;insulin-like growth factor IB;mechano growth factor;MGF;somatomedin-C.
Available
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Molecular Weight
34.7 kDa
Gene symbol
IGF1
Gene Fullname
insulin like growth factor 1
Protein size
Recombinant
Product format
Liquid or Lyophilized powder
Reconstitution and storage
-20°C or -80°C
Description of target
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation (PubMed:21076856, PubMed:24132240). Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb (By similarity). Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (PubMed:19578119, PubMed:22351760, PubMed:23696648, PubMed:23243309).
Protein name
Insulin-like growth factor I
Storage Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close