Comparison

TGFB Recombinant Protein (Human)

Item no. OPCA00694-1MG
Manufacturer AVIVA Systems Biology
Amount 1 mg
Category
Type Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence <b>Partial Protein:</b> DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Citations Intron-exon structure of the human transforming growth factor-beta precursor gene.Derynck R., Rhee L., Chen E.Y., van Tilburg A.Nucleic Acids Res. 15:3188-3189(1987)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CED;DPD1;IBDIMDE;LAP;latency-associated peptide;prepro-transforming growth factor beta-1;TGFB;TGFbeta;TGF-beta1;TGF-beta-1;transforming growth factor beta1;transforming growth factor beta-1 proprotein.
Available
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Molecular Weight
16.6 kDa
Gene symbol
TGFB1
Gene Fullname
transforming growth factor beta 1
Protein size
Recombinant
Product format
Liquid 10mM Tris-HCl, 1mM EDTA (pH 8.0), 50% glycerol
Reconstitution and storage
Store at -20°C; for extended storage, conserve at -20°C or -80°C. Store working aliquots at 4°C for up to one week. Avoid repeated freeze/thaw cycles.
Description of target
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP) (PubMed:25310401). Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells. Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus (PubMed:25893292). Can induce epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types (PubMed:25893292).
Protein name
Transforming growth factor beta-1
Purification
Affinity purified using IMAC
Concentration
Varies by lot. See vial for concentration.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close