« Back
Home /
Recombinant rat Vesicle-fusing ATPase

Recombinant rat Vesicle-fusing ATPase

Item no.	OPCA01072-1MG
Manufacturer	AVIVA Systems Biology
Amount	1 mg
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Molecular Targets for Neuroscience Neural Signaling By Cell Type Carcinoma Hematology Leukemia Lymphoma Peptides & Proteins Recombinant Proteins Cardiovascular Research Atherosclerosis
Type	Proteins Recombinant
Format	Liquid
Specific against	Rat (Rattus norvegicus)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	QAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNHQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSII
Citations	Plk2 attachment to NSF induces homeostatic removal of GluA2 during chronic overexcitation.Evers D.M., Matta J.A., Hoe H.S., Zarkowsky D., Lee S.H., Isaac J.T., Pak D.T.Nat. Neurosci. 13:1199-1207(2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	NEM-sensitive fusion protein;N-ethylmaleimide-sensitive factor;N-ethylmaleimide-sensitive fusion protein;vesicle-fusing ATPase;vesicular-fusion protein NSF.
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Molecular Weight	26.5 kDa
Gene symbol	Nsf
Gene Fullname	N-ethylmaleimide sensitive factor, vesicle fusing ATPase
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin. Interaction with AMPAR subunit GRIA2 leads to influence GRIA2 membrane cycling.
Protein name	Vesicle-fusing ATPase
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPCA01072-1MG-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer