Comparison

Recombinant Tubulin beta-1 chain (Chicken)

Item no. OPCA01173-100UG
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Proteins Recombinant
Format Liquid
Specific against Chicken (Gallus gallus domesticus)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATVSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAV
Citations Apparent gene conversion between beta-tubulin genes yields multiple regulatory pathways for a single beta-tubulin polypeptide isotype.Sullivan K.F., Lau J.T.Y., Cleveland D.W.Mol. Cell. Biol. 5:2454-2465(1985)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Beta-tubulin class-I.
Available
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Molecular Weight
53.3 kDa
Protein size
Recombinant
Product format
Liquid or Lyophilized powder
Reconstitution and storage
-20°C or -80°C
Description of target
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Protein name
Tubulin beta-1 chain
Storage Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close